Beta-Lactamase DataBase (BLDB): Structure and Function
Sequence alignment for the SIM beta-lactamase family
SIM-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240......
MRTLLILCLFGTLNTAFAEEAQPDLKIEKIEEGIYLHTSFQEYKGFGIVKKQGLVVLDNHKAYLIDTPASAGDTEKLVNWLEKNDFTVNGSISTHFHDDSTAGIEWLNTKSIPTYASKLTNELLNKNGKTQAKHSFDKESFWLVKNKIEIFYPGPGHTQDNEVVWIPNKKILFGGCFIKPNGLGNLSDANLEAWPGSAKKMISKYSKAKLVIPSHSEIGDASLLKLTWEQAIKGLNESKSKPPLIN |
SIM-2 | ...................................................................................................................................................................................................D.................................................. | 99.59 % |
Last updated: January 08, 2024.
If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.
The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).
Contact: contact@bldb.eu
Live statistics (since December 3rd, 2023)