Beta-Lactamase DataBase (BLDB): Structure and Function
Sequence alignment for the CGB beta-lactamase family
CGB-1
| ........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240..
MKKSIPFFIISMLLSPLANAQDTQVRDFVIEPQIQPNFYIYKTFGVFGGKEYSTNAVYLVTKKGVVLFDVPWQKTQYQSLMDTIQKRHHLPVIAVFATHSHEDRAGDLSFYNKKGIKTYATAKTNEILKKEGKATSTEIIKTGKPYRIGGEEFVVDFLGEGHTADNVVVWFPKYKILDGGCLVKSKAAADLGYTGEANVAQWPKTMEKLKSKYAQATLIIPGHDEWKGGGHVEHTLDLLNKK |
| CGB-2 | ..................T..T..........................................................L.......N.....................................L...D.......L..............I..............................................E.....T...D..S............................ | 95.04 % |

Last updated: April 06, 2026.
If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.
The development of the BLDB database was funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).
Contact: contact@bldb.eu
Live statistics (since March 29th, 2025)