Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the XCC beta-lactamase family

XCC-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290......
MLNRRQFLSMTGASVLIAASRPAWALSPVVNVDDMLRARWAEIQRGTGGRLGTCLLDSGSGWRIGQRENERFPMCSTFKFVLAAAVLQRVDKGELRLTQQIKIRASDMLEHAPVTERHVGGSLSVAELCQATMIHSDNPAANLLFPLIGDPPGLTRFLRGIGDTKTRSDRLE-AMNGFAPGEPRDTTTPAAMAATLRTLLLGDALQPASRKQLTAWMIDNRTGDDCLRAGLPRDWKIGDKTGSNGTDTRNDIAIIWPPGRAAPLLLTAYLNGATVDAAARDAALKAVAEAVRDLVG
XCC-2 ............................................................................................................................................................................P...........................................................................................................................  99.66 %
XCC-3 ....................K.SQ.V.L.ASPIAE..YK.......S.....IS..N.DT..H......................................................................................N......................PE...............................R........................................................................G.................  91.55 %
XCC-4 ....................K.SQ.V.L.ASPIAE..YK.......S.....IS..N.DT..H......................................................................................N......................PE........................................................................................................G.........A.......  91.55 %
XCC-5 ....................K.SQ.V.L.ASPIAE..YK.......S.....IS..N.DT..H......................................................................................N......................PE....................................Q...................................................................G.................  91.55 %
XCC-6 ....................K.SQ.V.L.ASPIAE..YK.......S.....IS..N.DT..H......................................................................................N......................PE....................................................................................................I...G.................  91.55 %
XCC-7 ....................K.SQ.V.L.ASPIAE..YK.......S.....IS..N.DT..H......................................................................................N.....L................PE..................................................G.....................................................G.................  91.22 %
XCC-8 ......................SQ.V.L.ASPIAE..YK....E..S.....IG..N.DT..H....................................................................................V........................PE........................................................................................................G.........A.......  91.55 %
XCC-9 ............................................................................................................................................................................P................................H..........................................................................................  99.32 %
XCC-10 ......................SQ.V.L.ASPIAE..YK....E..S.....IG..N.DT..H.............................................................................................................PE...........................................................................................................V..............  92.23 %
XCC-11 ......L.....................................................................................................................................................................P...........................................................................................................................  99.32 %
XCC-12 ..........A.................A..EY.V.................IS..N.VT..H.................................................S....................................N.......M..............PE......................................................................................T.................G.................  93.92 %
XCC-13 ............................A..EY.V.................IS..N.VT..H..............................................................................................M..............PE...................................................................................................A.......V..............  94.93 %
XCC-14 ............................A..EY.V.................IS..N.VT..H.............................................................................................................P...................................................................................L.....................G.................  95.61 %
XCC-15 ............................A..EY.V.................IS..N.VT..H......................................................................................N......................PE..........................................................................................................................  95.61 %
XCC-16 .....................................................................................................................................................N......................PE...............V......................................................................T.................G.................  97.97 %
XCC-17 ........................T............................................................................................................................N......................PE.........C............................................................................T.................G.................  97.64 %
XCC-18 .....................................................................................................................................................N......................PE.........C............................................................................T.................G.................  97.97 %
XCC-19 ................................................................................I................M...................................................N......................PE........................................................................................................G.................  97.97 %
XCC-20 ............................A....................................................................M...................................................N......................PQ........................................................................................................G.................  97.97 %
XCC-21 ............................A..............................T..H...........................................................................................................I.PE.......................................A................................................................G.................  97.30 %
XCC-22 ........................................................................................Q.................................................................................I.PE........................................................................................................G.................  98.31 %
XCC-23 ............................A...............................................................................................................................................PE..................................................................................................................A.......  98.65 %
XCC-P1 ----------------------------MASPIAE..YK....E..S.....IG..N.DT..H.............................................................................................................PE...........................................................................................................V..............  83.78 %
A-XCC phylogenetic tree

Last updated: October 13, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu