Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the PLES beta-lactamase family

PLES-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.........
MKVLGRTFFRAAAVVISCWSFAGLAQNSLVKEQDTAALSAQVKSVEQTLGARVGVSVFIPSQGVVWNYHGDQRFPMMSTFKTLACAKILSDVDAGKLALNDTVKVRSEDLMEYSPVLRPLAGTDITLQAACQATMETSDNTAANLVLEKIGGPAALTAYLQSIGDNVTRLDRNEPTLNEAAKNDPRDTTTPNAINHTLNTLVLGETLSSTSRQQLKTWMQDNKVADGLLRSVLPQGFQIADRSGAGGFGSRGITALVWSAQQEPMFVSIYLTQTEATFDERNAAIVTIGKSIFDTFLTR
PLES-2 ..........................S....A.......................................................M.T.........K........................................................................................................................................V..............................................................  97.99 %
PLES-3 .........................................M.............................................M.........................................................................................................................A..........................V..............................................................  98.66 %
PLES-4 ....................L.....ST..NA................................A......................M.A..................................................................................................................................................V.........................D..................................P.  96.32 %
PLES-5 .....L.....................A...A.......................................................M......................V....................................A................................V............................A..........................V......................T................S......................  96.32 %
PLES-6 ..........................S....A.......................................................M.........T......................................................S...........................V..............................................................................................................V.......  97.66 %
PLES-7 ...........................A...A.......T...............................................M..............................................................................................H.L...................................................V..............................................................  97.66 %
PLES-8 ....................L.....ST...A.......................................................M.......................................................................................................D...........................................................................................................  97.99 %
PLES-9 ....................L.....S............................................................M..............................................................................................H.....................................................V.........................D....................................  97.99 %
A-PLES phylogenetic tree

Last updated: October 13, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu