Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the PC1 beta-lactamase family

PC1-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.
MKKLIFLIVIALVLSACNSNSSHAKELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
PC1-2 ........A............................................................................I.........................E......A.................................................................................................S..C.............................................................  97.86 %
PC1-3 ........A..................................N...................................................................E................................................................................K..N......F...N..........................................................................  97.51 %
PC1-4 ...............................................................................................................E................................................................................K..N......F...N..........................................................................  98.22 %
PC1-5 .........M.....................................................................................................E................................................................................K..N......F...N..........................................................................  97.86 %
PC1-6 ............................................................................................................A..E......K...........N.......I.K...K...............................................K..N..........N........I.................................................................  96.09 %
PC1-7 ...........................................N...................................................................E................................................................................K..N......F...N..........................................................................  97.86 %
A-PC1 phylogenetic tree

Last updated: October 13, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu