Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the OXY beta-lactamase family

OXY-1-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290....
MLKSSWRKTALMAAAAVPLLLASGSLWASADAIQQKLADLEKRSGGRLGVALINTADDSQTLYRGDERFAMCSTGKVMAAAAVLKQSESNPEVVNKRLEIKKSDLVVWSPITEKHLQSGMTLAELSAAALQYSDNTAMNKMISYLGGPEKVTAFAQSIGDVTFRLDRTEPALNSAIPGDKRDTTTPLAMAESLRKLTLGNALGEQQRAQLVTWLKGNTTGGQSIRAGLPASWAVGDKTGAGDYGTTNDIAVIWPENHAPLVLVTYFTQPQQDAKSRKEVLAAAAKIVTEGL---
OXY-1-2 ........................................................................................................................................................................................................................................V......G...................................................---  99.31 %
OXY-1-3 ...............................................................................................................................................................................................................................................G...................................................---  99.66 %
OXY-1-4 .............-..........................................................................................................................................................................................................................V..........................................................---  99.31 %
OXY-1-6 .....................................................................................................................................................................................................................................................................P...............K.............---  99.31 %
OXY-1-7 ........................................................................................................................................................................................................................................V..........................................................---  99.66 %
OXY-1-8 .............-.....................................................................................................................................................................................................................................................................................---  99.66 %
OXY-1-9 ...........................................................................................D............................................................................................................................................V......G...................................................---  98.97 %
OXY-2-1 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............H....A.........T..T.....E...S...............D.............................E..V......................D..................N................---  89.35 %
OXY-2-2 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V......................D....I.............N................---  89.00 %
OXY-2-3 .I......I.ML.--.........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V......G...............D..................N................---  88.66 %
OXY-2-4 .I......I.ML.--.........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V......................D..................N................---  89.00 %
OXY-2-6 .I......I.ML.-.........SA....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V......................D..................N................---  89.00 %
OXY-2-7 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V......................D..................N................---  89.35 %
OXY-2-8 .I......I.ML.-.........SA....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S.............................................E..V.........................................N................---  89.69 %
OXY-2-9 .I......I.ML.--.........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V......T...............D..................N................---  88.66 %
OXY-2-10 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V.........................................N........T.......---  89.35 %
OXY-2-11 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S.............................................E..V......................D..................N................---  89.69 %
OXY-2-12 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V.........................................N................---  89.69 %
OXY-2-13 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.GH...........H....A.........T..T.....E...S...............D.............................E..V......................D..................N................---  89.00 %
OXY-2-14 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V......S...............D..................N................---  89.00 %
OXY-2-15 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........--.T.....E...S...............D.............................E..V......................D....I.............N................---  88.66 %
OXY-2-16 .I......I.ML.-..........A....T...H...TA..................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S.............................................E..V.........................................N................---  89.69 %
OXY-2-17 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.......D.NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V.........................................N........T.......---  89.00 %
OXY-2-18 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S.............................................E..V.........................................N................---  90.03 %
OXY-2-19 .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S...............D.............................E..V......G...............D..................N................---  89.00 %
OXY-2-20 .I......I.ML.-.........SA....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A.........T..T.....E...S.............................................E..V.........................................N........T.......---  89.35 %
OXY-2-b .I......I.ML.-..........A....T...H...T...................N..I.............S...............K.........NAA.........................T..........LI.G............R....A........ST..T.....E...S...............D.............................E..V......S...............D..................N................---  88.66 %
OXY-3-1 .I.T....S..I..-.L....C.S....N--...........ST.........D.T.N..I.............................KD.........A........V...............................G............R.................T.....E.............H......................................V....................................L.......D.............---  90.03 %
OXY-3-2 .M.T....S..I..-.L....C.S....N--...........ST.........D.T.N..I.............................KD....M....A........V...............................G............R.................T.....E.............H......................................V....................................L.......D.............---  89.69 %
OXY-3-3 .M.T....S..I..-.L....C.S....N--...........ST.........D.T.N..I.............................KD.........A........V...............................G............R.................T.....E.............H......................................V....................................L.......D.............---  90.03 %
OXY-4-1 ........S....-.................TL........................................................H.D................................................I.G........................M.......................................................................G...................................................---  96.56 %
OXY-4-2 ........S....-.................TL..................................................F.....H.D................................................I.G........................M.......................................................................G...................................................---  96.22 %
OXY-4-3 ........S....-.V...............TL........................................................H.D................................................I.G........................M.......................................................................G...................................................---  96.22 %
OXY-4-4 ........S....-.................TL........................................................H.D................................................I.G.............N..........M.......................................................................G...................................................---  96.22 %
OXY-4-5 ........S....-.................TL........................................................H.D................................................I.G........................M.......................................................................G............................L......................---  96.22 %
OXY-5-1 .............-............................H...........................................................A.....................................I.G........................M...........................................................................................................................---  97.94 %
OXY-5-2 .............-........................................................................................A.....................................I.G............L...........M...........................................................................................................................---  97.94 %
OXY-5-3 .............-........................................................................................A.....................................I.G........................M.......................................T...................................................................................---  97.94 %
OXY-6-1 ........S................................................................................H.D.......................................................................................................................................................................................................---  98.97 %
OXY-6-2 ........S....-...........................................................................H.D.......................................................................................................................................................................................................---  98.63 %
OXY-6-3 ........S..............................................T.................................H.D.......................................................................................................................................................................................................---  98.63 %
OXY-6-4 ........S.............................N..................................................H.D.......................................................................................................................................................................................................---  98.63 %
OXY-7-1 ...N....S....-.................T..........S..............................................H.D.........................................................................................................................................E.............................................................---  97.25 %
OXY-8-1 .I.T....I..I..-TL....C.S....N.....R..T....S............T.N..I...........................VDNQ.L................V.................T.............G.....D......R.................T.....E...........I.H....................................G.V..........................................................---  89.00 %
OXY-8-2 .I.C.......I..-TL....C.S....N.....R..T....S............T.N..I...........................VDNQ.L................V.................T.............G.....D......R.................T.....E.............H..............................S.....G.V..........................................................---  89.35 %
OXY-8-3 .I.T....I..I..-TL....C.S....N.....R..T....S............T.N..I...........................ADNQ.L................V.................T.............G.....D......R..D..............T.....E.............H..............................S.....G.V..........................................................---  88.66 %
OXY-9-1 .M.T....S..I..-.L....C.S....N--...........NT.........D.T.N..V......H....................ADNQ.L................V...............................G............H..............T..T.....E.............H.....Y........................S.....G.V........E...................................D.............QHK  86.73 %
A-OXY phylogenetic tree

Last updated: October 13, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu