Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the OKP beta-lactamase family

OKP-A-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280......
MRYVRLCLISLIAALPLAVFASPPPLEQITRSESQLAGRVGYVEMDLVSGRTLAAWRANERFPLMSTFKVLLCGAVLARVDAGDEQLDRRIRYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAGNLLLKSVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDVRDTTTPASMAATLRKLLTSHTLSARSQQQLLQWMVDDQVAGPLIRAVLPAGWFIAEKTGAGERGSRGIVALLGPNGKAERIVVIYLRDTPASMAERNQQIARIGAALIEHWQR
OKP-A-2 ........F..............Q....V..................A..........S.........................................................................................................................................................................D...................................T.....................  97.55 %
OKP-A-3 ...............................................A..........S......................................................................................................................................A..D...............................D...................................T.........K...........  97.55 %
OKP-A-4 ........F......................................A..........S.........................................................................................................................................................................D...................................T.....................  98.25 %
OKP-A-5 .......................Q......L................A..........S..........................R...........................................................................................................A..D...............................D...................................T.....................  96.85 %
OKP-A-6 ..................A....Q....V..................A..........S..........................R..................................................R........................................................A..D...............................D...................................T.........K...........  95.80 %
OKP-A-7 ..C....................Q......L................A..........S..........................R.......P...................................................................................................A..D...............................D...................................A.........K...........  95.80 %
OKP-A-8 ..................A.........V..................A..........S.........................................................................................................................................................................D...................................T.....................  97.90 %
OKP-A-9 ...............................................A..........S..........A...........................................................................................................................A..D...............................D...................................T.........K...........  97.20 %
OKP-A-10 ..C......P....................L................A..........S......................................................................................................................................A..D...............................D..........................M........T.........K...........  96.15 %
OKP-A-11 ..................A.........V..................A..........S......................................................................................................................................A..................................D...................................T.....................  97.55 %
OKP-A-12 ..................A....Q....V..................A..........S......................................................................................................................................A..................................D...................................T.....................  97.20 %
OKP-A-13 ...I....F......................................A..........S.........................................................................................................................................................................D...................................T.....................  97.90 %
OKP-A-14 ...I....F......................................A..........S............................................................................................................................T............................................D...................................TI....................  97.20 %
OKP-A-15 ........F......................................-----......S.........................................................................................................................................................................D...................................T.....................  96.85 %
OKP-A-16 .................VA....Q....V..................A..........S......................................................................................................................................A..................................D...................................T.....................  96.85 %
OKP-A-17 ........F...................V..................A..........S......................................................................................................................................A..................................D...................................T.....................  97.55 %
OKP-A-19 ........F......................................A..........S................................S........................................................................................................................................D...................................T.....................  97.90 %
OKP-A-21 ..................A.........V..................A..........S......................................................................................................................................A..................................D...................................T......H..............  97.20 %
OKP-B-1 .......................Q.....KI..G.............A...M......S................................H...........................................................................................T.......TPS................R.................D..................D..............A.T.........G...........  93.71 %
OKP-B-2 .......................Q.....KI..G.............A..........S................................H...........................................................................................T.......TPS................R.................D..................D..............A.T.........G...........  94.06 %
OKP-B-3 .......................Q.....KI................A..........S................................H............................................I..............................................T.......TPS................R.................D..................D..............A.T.V.......G...........  93.71 %
OKP-B-4 .......................Q.....KI................A..........S................................H...........................................................................................T.......TPS................R.................D..................D................T.V.......G...........  94.41 %
OKP-B-5 .......................Q.....KI................A..........S................................H....................................T.......I..............................................T.......TPS................R.................D..................D................T.V.......G...........  93.71 %
OKP-B-6 .......................Q.....KI................A..........S................................H...........................................................................................T.......TPS................R.................D..................D..............A.T.........G...........  94.41 %
OKP-B-7 .......................Q.....KI................A..........S................................H............................................I..............................................T.......TPS................R.................D..................D..............A.T.........G...........  94.06 %
OKP-B-8 .......................Q.....KI................A..........S................................H....................................T.......I..............................................T.......TPS................R.................D..................D..............A.T.........G...........  93.71 %
OKP-B-9 .......................Q.....KI...........I....A..........S................................H...........................................................................................T...R...TPS................R.................D..................D..............A.T.V.......G...........  93.36 %
OKP-B-10 .......................Q.....KI................A..........S................................H....................................T.......I...........................................N..T.......TPS................R.................D..................D..............A.T.........V...........  93.36 %
OKP-B-11 ............T..........Q.....KI................A......T...S................................H............................................I..............................................T.......TPS................R.................D..................D................T.V.......G...........  93.36 %
OKP-B-13 ...I...................Q.....KI................A..........S................................H....................................T.......I..............................................T.......TPS................R.................D..................D..............A.T.........V...........  93.36 %
OKP-B-15 ............T..........Q.....KI................A..........S................................H...........................................................................................T...R...TPS.......L........R.................D..................D..............A.T.........G...........  93.36 %
OKP-B-16 ...F...................Q.....KI................A..........S................................H............................................I..............................................T.......TPS................R.................D..................D................T.V.......G...........  93.71 %
OKP-B-17 .......................Q.....KI..G.............A..........S................................H...........................................................................................T.......TPS................R.................D..................D................T.V.......G...........  94.06 %
OKP-B-18 .......................Q.....KI..G.............A..........S................................H............................................I..............................................T.......TPS..................................D..................D..............A.T.........G...........  94.06 %
OKP-B-19 .......................Q.....KI..G.............A...M......S................................H....................................T.......I..............................................T.......TPS................R.................D..................D................T.V.......G...........  93.01 %
OKP-B-20 .......................Q.....KI................A..........S................................H....................................T.......I..............................................T.......TPS................R.................D..................D..............A.T.V.......G...........  93.36 %
OKP-B-21 .......................Q.....KI..G.............A..........S................................H...........................................................................................T.......TPS..................................D..................D..............A.T.....E...G...........  94.06 %
OKP-B-22 .......................Q.....KI................A..........S................................H...........................................................................................T.......TPS................R.................D..................D..............A.T.T.......G...........  94.06 %
OKP-B-23 ......Y................Q.....KI................A..........S................................H............................................I..............................................T.......TPS................R.................D..................D..............A.T.........G...........  93.71 %
OKP-B-24 .......................Q.....KI................A..........S................................H....................................T.......I.S...........F................................T.......TPS................R.................D..................D................T.V.......G...........  93.01 %
OKP-B-26 ...............................................A..........S......................................................................................................................................A..D...............................D...............................N...T.........K...........  97.20 %
OKP-B-33 .......................Q.....KI................A..........S................................H...H........................................I..............................................T.......TPS................R.................D..................D..............A.T.........G...........  93.71 %
OKP-B-34 .......................Q.....KI................A..........S................................H....................................T.......I..............................................T.......TPS................R.................D..................D..............A.T.........V...........  93.71 %
OKP-B-36 ............T..........Q.....KI................A..........S................................H............................................I..............................................T.......TPS................R.................D..................D..............A.T.........G...........  93.71 %
OKP-B-40 .......................Q.....KI................A..........S................................H....................................T.......I..............................................T...R...TPS................R.................D..................D..............A.T.........G...........  93.36 %
OKP-B-41 .......................Q.....KI..G.............A..........S................................H............................................I..............................................T.......TPS................R.................D..................D..............A.T.........G...........  93.71 %
OKP-B-45 .......................Q.....KI..G.............A..........S................................H....................................T.......I..............................................T.......TPS................R.................D..................D................T.V.......G...........  93.36 %
OKP-B-P2 ------.................Q.....KI................A..........S................................H...........................................................................................T.......TPS.......L........R.................D..................D..............A.T.........G......-----  90.21 %
OKP-C-1 .......V...L.S.....H...Q.....KL.....S....MI....A.....T....D....M.......................E...H.......A...................T..........A....GT...................................A..................AQH................R.........V.P.....D........A.........D..P.......................G...........  88.46 %
OKP-D-1 ....H..V...F.C...PL..G.Q.....KI.....S..........A..........D.....T..................V.R.....H.......A...................................DTL...........T..........R..Q...........................AKH.........V......R.................D........A.........D..........M.....TI........A...........  87.41 %
A-OKP phylogenetic tree

Last updated: October 13, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu