Beta-Lactamase DataBase (BLDB): Structure and Function
Beta-Lactamase DataBase
Beta-Lactamase DataBase - Structure and Function Home Enzymes Structures Mutants Kinetics BLAST
Beta-Lactamase DataBase

Sequence alignment for the FRI beta-lactamase family

FRI-1
........10........20........30........40........50........60........70........80........90.......100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290........
-MFFFKKGASTFIFLLCLPL---NSFASQVINSVEEMRELETSFGGRIGVYILNPKNGKEFAYRQDERFPLCSSFKAFLAASVLKRTQEKSVSLDDMVEYSGRVMEKHSPVSEKYRKTGASVQTLAKAAIQYSDNGASNLLMERYIGGPEGLTAFMRSTGDTDFRLDRWELELNTAIPGDERDTSTPKAVAMSLKNIAFGSVLDAKNKSLLQEWLKGNTTGNARIRAAVPDKWVVGDKTGTCGFYGTANDVAILWTDANSPAVMAVYTTRPNQNDKHDEAVIKNAAKIAIKAVYGSYK
FRI-2 -......S......F.....---......ES..I.Q.....A............T......S.......................K..D........M........................R...................................................S..........................................................D.....................P...........................DS.....N.......  93.54 %
FRI-3 -...L..AQVHLF.F.....---......ES..I.Q.....AA...........T......S.......................K..D........M........................R...................................................S..........................................................D.....................P............................S.....N.......  91.50 %
FRI-4 -......S............---......ES.G..Q..................T......S..........................D........M..................E.........................................................S................I..N.................D..............................L......I....P.......................T..........N.....T.  93.20 %
FRI-5 --M.LC.KT.IMS.....SFISF..L.T.EN...AK.K....A........L..TG.....S..............V.........I.S..I....S...V...............EK........M...............................................S.....K....................I.N....A...D...........V..............................P.N.....I...............T..........DS......  83.84 %
FRI-6 -......S............---......ES.G..Q..................T......S..........................D........M..................E.........................................................S...................N.................D.....................................I....P.......................T..........N.....T.  93.88 %
FRI-7 -......S.R..........---......ES.G..Q..................T......S..........................D........M..................E.........................................................S...................N.................D.....................................I....P.......................T..........N.....T.  93.54 %
FRI-8 MLKKMR.N.IILS.S....FASS....N.ER.GLAQIK....V........L..TE.....S...N..........V........K..D..F..N.T..................LE.........M..................V................E...........S.....K...........................A...D..Q........V..............................P.S.....I......T........TI.........N.......  81.54 %
FRI-9 -...L..S....V.......---......ES.G..Q.K...N............T......S..........................D........M..................E.........................................................S.............T.....N.................D.....................................I....P.......................T..........N.....T.  92.18 %
FRI-10 -......S......F.....---......ES..I.Q.....A............T......S.......................K...........M........................R...................................................S...S.............................L........................D.....................P..................................N.......  93.88 %
FRI-11 -...LR.S............---......ES....Q..................T......S.......................K...........M........................R...................................................S..........................................................D.....................P..................................N.......  94.90 %
A-FRI phylogenetic tree

Last updated: October 13, 2021.

If you use BLDB please cite: Naas, T.; Oueslati, S.; Bonnin, R. A.; Dabos, M. L.; Zavala, A.; Dortet, L.; Retailleau, P.; Iorga, B. I., Beta-Lactamase DataBase (BLDB) – Structure and Function. J. Enzyme Inhib. Med. Chem. 2017, 32, 917-919.

The development of the BLDB database is funded in part by the JPIAMR transnational project DesInMBL, the Région Ile-de-France (DIM Malinf) and the Laboratory of Excellence in Research on Medication and Innovative Therapeutics (LERMIT).

Contact: contact@bldb.eu